C7orf31 antibody (N-Term)

Catalog No. ABIN631840

This Rabbit Polyclonal antibody specifically detects C7orf31 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for C7orf31 antibody (N-Term) (ABIN631840)

Target: C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C7orf31 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C7orf31 Antibody

Binding Specificity: N-Term

Specificity: C7 ORF31 antibody was raised against the N terminal Of C7 rf31

Purification: Affinity purified

Immunogen: C7 ORF31 antibody was raised using the N terminal Of C7 rf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C7ORF31 Blocking Peptide, (ABIN938175), is also available for use as a blocking control in assays to test for specificity of this C7ORF31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C7orf31

Target: C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))

Alternative Name: C7ORF31

Background: The function of C7orf31 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 68 kDa (MW of target protein)